Bacterial taxon 1392858
Locus CO715_18190
Protein ATI07477.1
nucleoside/nucleotide kinase family protein
Escherichia coli M12
Length 237 aa, Gene n/a, UniProt n/a
>ATI07477.1|Escherichia coli M12|nucleoside/nucleotide kinase family protein
MKIELTVNGLKVQAQYHVDEIENVHKPLLRMLAALQTVNPQRRTVVFLCAPPGTGKSTLTTFWEYLAQQDPELPAIQTLPMDGFHHYNSWLDAHQLRPFKGAPETFNVAKLAENLRQVVEGDCTWPQYDRQKHDPVEDALHVTAPLVIVEGNWLLLDDEKWCQLAQFCDFSIFINAPATALRERLVGRKLAGGLSLADADAFYDRTDGPNVRRVLEESLPANLTLMMTATGEYHLVD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.33 | 5.6e-16 | ○○○○○ 0.82 | 0.8242422675117184 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.74 | 2.5e-25 | ○○○○○ 0.91 | 0.9099957793680002 | 29101196 |
Retrieved 2 of 2 entries in 32.1 ms
(Link to these results)