Bacterial taxon 1392858
Locus CO715_19500
Protein ATI07712.1
osmotically-inducible lipoprotein B
Escherichia coli M12
Length 72 aa, Gene n/a, UniProt n/a
>ATI07712.1|Escherichia coli M12|osmotically-inducible lipoprotein B
MFVTSKKMTAAVLAITLAMSLSACSNWSKRDRNTAIGAGAGALGGAVLTDGSTLGTLGGAAVGGVIGHQVGK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.09 | 7.0e-12 | ○○○○○ 0.11 | 0.11109019080911053 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.36 | 1.8e-5 | ○○○○○ 0.26 | 0.26319313519653037 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)