Bacterial taxon 1392858
Locus CO715_11135
Protein ATI06206.1
osmotically-inducible lipoprotein E
Escherichia coli M12
Length 112 aa, Gene n/a, UniProt n/a
>ATI06206.1|Escherichia coli M12|osmotically-inducible lipoprotein E
MNKNMAGILSAAAVLTMLAGCTAYDRTKDQFVQPVVKDVKKGMSRAQVAQIAGKPSSEVSMIHARGTCQTYILGQRDGKAETYFVALDDTGHVINSGYQTCAEYDTDPQAAK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.94 | 7.9e-13 | ●●○○○ -1.32 | -1.3187609448383357 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.57 | 3.1e-6 | ●○○○○ -0.62 | -0.6166671068909176 | 29101196 |
Retrieved 2 of 2 entries in 1.9 ms
(Link to these results)