Bacterial taxon 1392858
Locus CO715_19660
Protein ATI07740.1
outer membrane protein OmpW
Escherichia coli M12
Length 212 aa, Gene n/a, UniProt n/a
>ATI07740.1|Escherichia coli M12|outer membrane protein OmpW
MKKLTVAALAVTTLLSGSAYAHEAGEFFMRAGSATVRPTEGAGGTLGSLGGFSVTNNTQLGLTFTYMATDNIGVELLAATPFRHKIGTRATGDIATVHHLPPTLMAQWYFGDASSKFRPYVGAGINYTTFFDNGFNDHGKEAGLSDLSLKDSWGAAGQVGVDYLINRDWLVNMSVWYMDIDTTANYKLGGAQQHDSVRLDPWVFMFSAGYRF
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.93 | 1.3e-99 | ●○○○○ -0.9 | -0.8997997482266222 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.7 | 1.1e-53 | ●○○○○ -0.44 | -0.4351450744944083 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)