Bacterial taxon 1392858
Locus CO715_13690
Protein ATI08811.1
oxidoreductase
Escherichia coli M12
Length 237 aa, Gene n/a, UniProt n/a
>ATI08811.1|Escherichia coli M12|oxidoreductase
MGAFTGKTVLILGGSRGIGAAIVRRFVTDGANVRFTYAGSKDAAEHLAQETGATAVFTDSADRDAVIDVVRKSGALDILVVNAGIGVFGDALELNADDIDRLFKINIHAPYHASVEAARQMPEGGRILIIGSVNGDRMPVAGMAAYAASKSALQGMARGLARDFGPRGITINVVQPGPIDTDANPANGPMRDMLHSLMAIKRHGQPEEVAGMVAWLAGPEASFVTGAMHTIDGAFGA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.8 | 1.6e-11 | ●○○○○ -0.87 | -0.8726757663742702 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.93 | 9.1e-12 | ○○○○○ 1.37 | 1.365887320501762 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)