Bacterial taxon 1392858
Locus CO715_11345
Protein ATI06246.1
peptide-methionine (R)-S-oxide reductase
Escherichia coli M12
Length 137 aa, Gene n/a, UniProt n/a
>ATI06246.1|Escherichia coli M12|peptide-methionine (R)-S-oxide reductase
MANKPSAEELKKNLSEMQFYVTQNHGTEPPFTGRLLHNKRDGVYHCLICDAPLFHSQTKYDSGCGWPSFYEPVSEESIRYIKDLSHGMQRIEIRCGNCDAHLGHVFPDGPQPTGERYCVNSASLRFTDGENGEEING
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.49 | 1.9e-8 | ●●○○○ -1.43 | -1.4335162526752092 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.04 | 8.3e-8 | ●●○○○ -1.34 | -1.3402514843059685 | 29101196 |
Retrieved 2 of 2 entries in 15.8 ms
(Link to these results)