Bacterial taxon 1392858
Locus CO715_16680
Protein ATI07207.1
peptidoglycan-binding protein LysM
Escherichia coli M12
Length 149 aa, Gene n/a, UniProt n/a
>ATI07207.1|Escherichia coli M12|peptidoglycan-binding protein LysM
MGLFNFVKDAGEKLWDAVTGQHDKDDQAKKVQEHLNKTGIPDADKVNIQIADGKATVTGDGLSQEAKEKILVAVGNISGIASVDDQVKTATPAAASQFYTVKSGDTLSAISKQVYGNANLYNKIFEANKPMLKSPDKIYPGQVLRIPEE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.84 | 2.2e-6 | ●○○○○ -0.67 | -0.6715410086383681 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.39 | 4.2e-6 | ●○○○○ -0.58 | -0.5776503022263805 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)