Bacterial taxon 1392858
Locus CO715_22145
Protein ATI08193.1
peptidyl-prolyl cis-trans isomerase
Escherichia coli M12
Length 93 aa, Gene n/a, UniProt n/a
>ATI08193.1|Escherichia coli M12|peptidyl-prolyl cis-trans isomerase
MAKTAAALHILVKEEKLALDLLEQIKNGADFGKLAKKHSICPSGKRGGDLGEFRQGQMVPAFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRN
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.23 | 0.016 | ○○○○○ 1.01 | 1.0105631582359513 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 4.7 | 5.3e-8 | ○○○○○ 1.53 | 1.5263361054591364 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)