Bacterial taxon 1392858
Locus CO715_21220
Protein ATI08024.1
periplasmic nitrate reductase electron transfer subunit
Escherichia coli M12
Length 149 aa, Gene n/a, UniProt n/a
>ATI08024.1|Escherichia coli M12|periplasmic nitrate reductase electron transfer subunit
MKSHDLKKALCQWTAMLALVVSGAVWAANGVDFSQSPEVSGTQEGAIRMPKEQDRMPLNYVNQPPMIPHSVEGYQVTTNTNRCLQCHGVESYRTTGAPRISPTHFMDSDGKVGAEVAPRRYFCLQCHVPQADTAPIVGNTFTPSKGYGK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.01 | 5.3e-19 | ●○○○○ -0.5 | -0.4981561707975643 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.02 | 7.7e-8 | ●○○○○ -0.08 | -0.08357654048507698 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)