Bacterial taxon 1392858
Locus CO715_15400
Protein ATI08826.1
periplasmic protein CpxP
Escherichia coli M12
Length 166 aa, Gene n/a, UniProt n/a
>ATI08826.1|Escherichia coli M12|periplasmic protein CpxP
MRIVTAAVMASTLAVSSLSHAAEVGSGDNWHPGEELTQRSTQSHMFDGISLTEHQRQQMRDLMQQARHEQPPVNVSELETMHRLVTAENFDENAVRAQAEKMANEQIARQVEMAKVRNQMYRLLTPEQQAVLNEKHQQRMEQLRDVTQWQKSSSLKLLSSSNSRSQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 8.21 | 2.0e-36 | ○○○○○ 2.26 | 2.258892261486888 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 12 | 3.4e-74 | ○○○○○ 3.05 | 3.0492433634615748 | 29101196 |
Retrieved 2 of 2 entries in 59.6 ms
(Link to these results)