Bacterial taxon 1392858
Locus CO715_07630
Protein ATI05597.1
peroxiredoxin OsmC
Escherichia coli M12
Length 143 aa, Gene n/a, UniProt n/a
>ATI05597.1|Escherichia coli M12|peroxiredoxin OsmC
MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGEKGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGIDASTFDGIIQKAKAGCPVSQVLKAEITLDYQLKS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.73 | 0.0012 | ●○○○○ -0.23 | -0.23150656458751964 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.76 | 0.00051 | ○○○○○ 1.33 | 1.3310434361222023 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)