Bacterial taxon 1392858
Locus CO715_05750
Protein ATI05273.1
phage tail protein
Escherichia coli M12
Length 117 aa, Gene n/a, UniProt n/a
>ATI05273.1|Escherichia coli M12|phage tail protein
MADFDNLFDAAIARADETIRGYMGTSATITSGEQSGAVIRGVFDDPENISYAGQGVRVEGSSPSLFVRTDEVRQLRRGDTLTIGEENFWVDRVSPDDGGSCHLWLGRGVPPAVNRRR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.68 | 1.2e-7 | ●●○○○ -1.47 | -1.4725330573397466 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.58 | 0.041 | ○○○○○ 0.01 | 0.008644997812919636 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)