Bacterial taxon 1392858
Locus CO715_05810
Protein ATI08738.1
phage tail protein
Escherichia coli M12
Length 246 aa, Gene n/a, UniProt n/a
>ATI08738.1|Escherichia coli M12|phage tail protein
MPTPNPLAPVKGAGTTLWVYKGNGDPYANPLSDVDWSRLAKVKDLTPGELTAESYDDSYLDDEDADWTATGQGQKSAGDTSFTLAWMPGEQGQQALLAWFNEGDTRAYKIRFPNGTVDVFRGWVSSIGKAVTAKEVITRTVKVTNVGRPSMAEDRSTVTATTGMTVTPASASVVKGQSTTLTVAFQPEGATDKSFRAVSADKTKATVSVSGMTITVKGVAAGKVNIPVVSGNGEFAAVAEINVTAS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.3 | 1.0e-10 | ●●○○○ -1.39 | -1.3942908019964235 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.84 | 0.00058 | ●○○○○ -0.25 | -0.2544576261548944 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)