Bacterial taxon 1392858
Locus CO715_05855
Protein ATI08741.1
phage tail protein
Escherichia coli M12
Length 67 aa, Gene n/a, UniProt n/a
>ATI08741.1|Escherichia coli M12|phage tail protein
EVFLPAQVPDSELDAWMESRIYPVMSDIPALSDLITSMVASGYDYRRDDDAGLWSSADLTYVITYEM
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.86 | 5.6e-23 | ●●○○○ -1.93 | -1.9292591825305039 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.15 | 7.1e-30 | ●●○○○ -1.36 | -1.3623679618163478 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)