Bacterial taxon 1392858
Locus CO715_05880
Protein ATI08742.1
phage tail protein
Escherichia coli M12
Length 62 aa, Gene n/a, UniProt n/a
>ATI08742.1|Escherichia coli M12|phage tail protein
EADEEPEDDVLMQKAAGLAGGVRFAPDGNEVIPASPDMAGMTEDDVMLMTVSEGIAGGVRYG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.55 | 5.6e-13 | ●○○○○ -0.19 | -0.19457622006547118 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.66 | 0.0012 | ○○○○○ 0.89 | 0.8928868061995936 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)