Bacterial taxon 1392858
Locus CO715_23635
Protein ATI08437.1
phage tail protein
Escherichia coli M12
Length 101 aa, Gene n/a, UniProt n/a
>ATI08437.1|Escherichia coli M12|phage tail protein
MLPQHSDIEIAWYASIQQEPNGWKTVTTQFYIQEFSEYIAPLQDAVDLEIATEEERSLLEAWNKYRVLLNRVDTSVALGMKLFVTHVTVIAITISKVQNVY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -1.24 | 0.025 | ○○○○○ 0.29 | 0.287813364877896 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.14 | 0.027 | ○○○○○ 0.78 | 0.7831390027046926 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)