Bacterial taxon 1392858
Locus CO715_04625
Protein ATI05083.1
phosphohydrolase
Escherichia coli M12
Length 231 aa, Gene n/a, UniProt n/a
>ATI05083.1|Escherichia coli M12|phosphohydrolase
MDLQHWQAQFENWLKNHHQHQDAAHDVCHFRRVWATAQKLAADDDVDMLVILTACYFHDIVSLAKNHPQRQRSSILAAEETRRLLREEFVQFPAEKIEAVCHAIAAHSFSAQIAPLTTEAKIVQDADRLEALGAIGLARVFAVSGALGVALFDGEDPFAQHRPLDDKRYALDHFQTKLLKLPQTMQTARGKQLAQHNAQFLVEFMAKLSAELAGENEGVDHKVIDAFSPAG
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.98 | 1.1e-13 | ●●○○○ -1.33 | -1.3279413694652855 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.71 | 7.0e-12 | ●●○○○ -1.27 | -1.2707723615610975 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)