Bacterial taxon 1392858
Locus CO715_13000
Protein ATI06543.1
phospholipid ABC transporter ATP-binding protein MlaF
Escherichia coli M12
Length 269 aa, Gene n/a, UniProt n/a
>ATI06543.1|Escherichia coli M12|phospholipid ABC transporter ATP-binding protein MlaF
MEQSVANLVDMRDVSFTRGNRCIFDNISLTVPRGKITAIMGPSGIGKTTLLRLIGGQIAPDHGEILFDGENIPAMSRSRLYTVRKRMSMLFQSGALFTDMNVFDNVAYPLREHTQLPAPLLHSTVMMKLEAVGLRGAAKLMPSELSGGMARRAALARAIALEPDLIMFDEPFVGQDPITMGVLVKLISELNSALGVTCVVVSHDVPEVLSIADHAWILADKKIVAHGSAQALQANPDPRVRQFLDGIADGPVPFRYPAGDYHADLLPGS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.55 | 1.1e-25 | ●○○○○ -0.19 | -0.19374163600847574 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.23 | 1.4e-10 | ○○○○○ 0.08 | 0.0806278727287768 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)