Bacterial taxon 1392858
Locus CO715_12985
Protein ATI06541.1
phospholipid-binding protein
Escherichia coli M12
Length 211 aa, Gene n/a, UniProt n/a
>ATI06541.1|Escherichia coli M12|phospholipid-binding protein
MFKRLMMVALLVIAPLSAATAADQTNPYKLMDEAAQKTFDRLKNEQPQIRANPDYLRTIVDQELLPYVQVKYAGALVLGQYYKSATPAQRDAYFAAFREYLKQAYGQALAMYHGQTYQIAPEQPLGDKTIVPIRVTIIDPNGRPPVRLDFQWRKNSQTGNWQAYDMIAEGVSMITTKQNEWGTLLRTKGIDGLTAQLKSISQQKITLEEKK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.2 | 2.0e-5 | ●○○○○ -0.54 | -0.5396767276330877 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.92 | 3.1e-8 | ○○○○○ 1.15 | 1.1545289080676657 | 29101196 |
Retrieved 2 of 2 entries in 2 ms
(Link to these results)