Bacterial taxon 1392858
Locus CO715_09770
Protein ATI05971.1
phospholipid:lipid A palmitoyltransferase
Escherichia coli M12
Length 186 aa, Gene n/a, UniProt n/a
>ATI05971.1|Escherichia coli M12|phospholipid:lipid A palmitoyltransferase
MNVSKYVAIFSFVFIQLISVGKVFANADEWMTTFGENITQTWQQPEHYDLYIPAITWHARFAYDKEKTDRYNERPWGGGFGQSRWDEKGNWHGLYAMAFKDSWNKWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPVTFQMTYIPGTYNNGNVYFAWMRFQF
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -0.75 | 0.0083 | ○○○○○ 0.39 | 0.3904672038883358 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.78 | 4.5e-26 | ○○○○○ 1.13 | 1.126987634186816 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)