Bacterial taxon 1392858
Locus CO715_01735
Protein ATI04562.1
phosphonate ABC transporter, permease protein PhnE
Escherichia coli M12
Length 259 aa, Gene n/a, UniProt n/a
>ATI04562.1|Escherichia coli M12|phosphonate ABC transporter, permease protein PhnE
MQTITIAPPKRSWFSLLSWAIVLAVLVVSWQGAEMAPLTLIKDGGNMATFAADFFPPDFSQWQDYLTEMAVTLQIAVWGTALAVVLSIPFGLMSAENLVPWWVYQPVRRLMDACRAINEMVFAMLFVVAVGLGPFAGVLALFIHTTGVLSKLLSEAVEAIEPGPVEGIRATGANKLEEILYGVLPQVMPLLISYSLYRFESNVRSATVVGMVGAGGIGVTLWEAIRGFQFQQTCALMVLIIVTVSLLDFLSQRLRKHFI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.69 | 9.9e-15 | ●●○○○ -1.27 | -1.2676426713473645 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.8 | 2.4e-5 | ○○○○○ 0.92 | 0.9206367260946922 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)