Bacterial taxon 1392858
Locus CO715_01745
Protein ATI04564.1
phosphonate C-P lyase system protein PhnG
Escherichia coli M12
Length 150 aa, Gene n/a, UniProt n/a
>ATI04564.1|Escherichia coli M12|phosphonate C-P lyase system protein PhnG
MHADTATRQHWMSVLAHSQPAELAARLKALNITADYEVIRTAETGLVQIQARMGGTGERFFAGDATLTRAAVRLTDGTLGYSWVLGRDKQHAERCALIDALMQQSRHFQNLSETLIAPLDADRMARIAARQAEVNASRVDFFTMVRGDNA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.53 | 9.1e-15 | ●●○○○ -1.23 | -1.232590140953556 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.56 | 1.4e-11 | ●●○○○ -1.03 | -1.0304121531464094 | 29101196 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)