Bacterial taxon 1392858
Locus CO715_01740
Protein ATI04563.1
phosphonate metabolism transcriptional regulator PhnF
Escherichia coli M12
Length 241 aa, Gene n/a, UniProt n/a
>ATI04563.1|Escherichia coli M12|phosphonate metabolism transcriptional regulator PhnF
MHLSTHPTSYPTRYQEIAAKLEQELRQHYRCGDYLPAEQQLAARFEVNRHTLRRAIDQLVEKGWVQRRQGVGVLVLMRPFDYPLNAQARFSQNLLDQGSHPTSEKLLSVLRPASGHVADALGITEGENVIHLRTLRRVNGVALCLIDHYFADLTLWPTLQRFDSGSLHDFLREQMGIALRRSQTRISARRAQAKECQRLEIPNMSPLLCVRTLNHRDGESSPAEYSVSLTRADMIEFTMEH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.97 | 4.8e-10 | ○○○○○ 0.96 | 0.9577757166309895 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 4.35 | 6.9e-42 | ○○○○○ 1.45 | 1.453518646486284 | 29101196 |
Retrieved 2 of 2 entries in 1.9 ms
(Link to these results)