Bacterial taxon 1392858
Locus CO715_20350
Protein ATI07868.1
PIG-L family deacetylase
Escherichia coli M12
Length 223 aa, Gene n/a, UniProt n/a
>ATI07868.1|Escherichia coli M12|PIG-L family deacetylase
MDKVLDSAILSSANKRKGILAIDAHPDDIELGCGASLARLAQKGIYIAAVVMTTGNSGTDGIIDRHEESRNALKILGCHQTIHLNFADTRAHLQLNDMISALEDIIKNQIPSDVEIMRVYTMHDADRHQDHLAVYQASMVACRTIPQILGYETPSTWLSFMPQVFESVKEEYFTVKLAALKKHKSQERRDYMRHDRLRAVAQFRGQQVNSDLGEGFVIHKMIL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.42 | 7.0e-22 | ○○○○○ 0.25 | 0.2506743743415987 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -0.57 | 0.0002 | ○○○○○ 0.43 | 0.4267716103676376 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)