Bacterial taxon 1392858
Locus CO715_06820
Protein ATI05452.1
porin
Escherichia coli M12
Length 327 aa, Gene n/a, UniProt n/a
>ATI05452.1|Escherichia coli M12|porin
MKLKKLPGFSLGLIALAVGNAYATQLLDDYSILSYITDEESPIEIKDNNSISNGEYLTTKDESHAVKVDDGVTGYINNASVMTSGDGSYGISVDSHNKVLYISDSDIKTSGSVSDKGNNQDVNGGITASAVVSEFGGTIVMNGDNSVETRGAYSAGLLSQVNDSGIVENNTRLETTDKTNIVTYGENAVGVLACSSPGESRTCVDAVDDEVSDSNSYEVISRADLKMNGGSITTNGTNSYGAYANGEKAYINLDYVALETGEHGSYAVAIRQGNIDIKIVLLQQKALKPPLQKYTMVESYFFPMSPRYQNKIKEYQLMHQISILKPK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.45 | 1.1e-53 | ●○○○○ -0.59 | -0.591838231195303 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.31 | 5.1e-12 | ○○○○○ 1.03 | 1.027880777418607 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)