Bacterial taxon 1392858
Locus CO715_12115
Protein ATI06388.1
prepilin peptidase
Escherichia coli M12
Length 269 aa, Gene n/a, UniProt n/a
>ATI06388.1|Escherichia coli M12|prepilin peptidase
MLFDVFQQYPAAMPVLATVGGLIIGSFLNVVIWRYPIMLRQQMAEFHGEMPSAQSKISLALPRSHCPHCQQTIRVRDNIPLFSWLMLKGRCRDCQAKISKRYPLVELLTALAFLLASLVWPESGWALAVMILSAWLIAASVIDLDHQWLPDVFTQGVLWTGLSAAWAQQSPLTLQDAVTGVLVGFIAFYSLRWIAGIVLRKEALGMGDVLLFAALGSWVGPLSLPNVALIASCCGLIYAVITKRGSTTLPFGPCLSLGGIATIYLQALF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.52 | 6.5e-11 | ●●○○○ -1.65 | -1.6490475853942832 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 4.13 | 2.4e-8 | ○○○○○ 1.41 | 1.4069905853087878 | 29101196 |
Retrieved 2 of 2 entries in 13.2 ms
(Link to these results)