Bacterial taxon 1392858
Locus CO715_12110
Protein ATI06387.1
prepilin peptidase A domain protein
Escherichia coli M12
Length 37 aa, Gene n/a, UniProt n/a
>ATI06387.1|Escherichia coli M12|prepilin peptidase A domain protein
MRLLIGPTDGESRDYLRWQTPVGRIRRFTPHPASYNK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.47 | 1.3e-5 | ●○○○○ -0.8 | -0.803822581672146 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 4.68 | 3.6e-5 | ○○○○○ 1.52 | 1.5232064152454035 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)