Bacterial taxon 1392858
Locus CO715_17505
Protein ATI07356.1
prepilin-type cleavage/methylation domain-containing protein
Escherichia coli M12
Length 187 aa, Gene n/a, UniProt n/a
>ATI07356.1|Escherichia coli M12|prepilin-type cleavage/methylation domain-containing protein
MPVKELGFSLLEVLIAMAISSVLLLGAARFLPALQRDSLTSTRKLALEDEIWLRVFTVAKHLQRAGYCHGSCTGEGLEIVGQGDCVIVQWDANSNGIWDREPVKESDQIGFRLKEHVLETLRGATSCEGKGWDKVTNPDAIIIDTFQVTRQDVSGFSPVLTVNMHAASKADPQTVVDASYSVTGSNL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.07 | 0.0001 | ●●○○○ -1.55 | -1.5541136489110514 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.27 | 0.0021 | ●●○○○ -1.18 | -1.1802199913770917 | 29101196 |
Retrieved 2 of 2 entries in 2.1 ms
(Link to these results)