Bacterial taxon 1392858
Locus CO715_09980
Protein ATI06009.1
protein HokE
Escherichia coli M12
Length 50 aa, Gene n/a, UniProt n/a
>ATI06009.1|Escherichia coli M12|protein HokE
MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.89 | 5.2e-6 | ●○○○○ -0.89 | -0.891245261642419 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.38 | 7.2e-5 | ●○○○○ -0.37 | -0.367961057906275 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)