Bacterial taxon 1392858
Locus CO715_17005
Protein ATI08844.1
protein HypA
Escherichia coli M12
Length 116 aa, Gene n/a, UniProt n/a
>ATI08844.1|Escherichia coli M12|protein HypA
MHEITLCQRALELIEQQAAKHGAKRVTGVWLKIGAFSCVETSSLAFCFDLVCRGSVAEGCKLHLEEQEAECWCETCQQYVTLLTQRVRRCPQCHGDMLQIVADDGLQIRRIEIDQE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.89 | 0.0038 | ●●○○○ -1.1 | -1.1007258599482757 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.38 | 0.01 | ●○○○○ -0.99 | -0.9928558705816145 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)