Bacterial taxon 1392858
Locus CO715_04925
Protein ATI05134.1
protein NapD
Escherichia coli M12
Length 87 aa, Gene n/a, UniProt n/a
>ATI05134.1|Escherichia coli M12|protein NapD
MHTNWQVCSLVVQAKSERISDISTQLNAFPGCEVAVSDAPSGQLIVVVEAEDSETLIQTIESVRNVEGVLAVSLVYHQQEEQGEETP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.61 | 2.4e-8 | ●●○○○ -1.67 | -1.6674084346481828 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.63 | 2.3e-8 | ●●○○○ -1.25 | -1.2542893264354376 | 29101196 |
Retrieved 2 of 2 entries in 67.1 ms
(Link to these results)