Bacterial taxon 1392858
Locus CO715_07415
Protein ATI05557.1
protein Sxy
Escherichia coli M12
Length 209 aa, Gene n/a, UniProt n/a
>ATI05557.1|Escherichia coli M12|protein Sxy
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLNYYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQNSLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.39 | 1.2e-14 | ○○○○○ 0.05 | 0.04661857240621237 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.99 | 1.2e-21 | ○○○○○ 1.17 | 1.1697600671078325 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)