Bacterial taxon 1392858
Locus CO715_11205
Protein ATI06219.1
protein YdjY
Escherichia coli M12
Length 225 aa, Gene n/a, UniProt n/a
>ATI06219.1|Escherichia coli M12|protein YdjY
MLQHYSVSWKKGLAALCLLAVAGLSGCDQQENAGAKVEYDGLSNSQPLRVDANNHTVTMLVQINGRFLTDDTRHGIVFKDGSNGHKSLFMGYATPKAFYEALKEAGGTPGENMTMDNKETTHVTGSKLDISVNWQGAAKAYSLDEVIVDSNGKKLDMRFGGNLTAAEEKKTGCLVCLDSCPVGIVSNATYTYGAVEKRGEVKFKGNASVLPADNTLATVTFKITE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.09 | 2.4e-20 | ●○○○○ -0.93 | -0.9327658184779424 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.85 | 5.2e-17 | ○○○○○ 1.35 | 1.3502388694330976 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)