Bacterial taxon 1392858
Locus CO715_01795
Protein ATI04574.1
protein YjdP
Escherichia coli M12
Length 109 aa, Gene n/a, UniProt n/a
>ATI04574.1|Escherichia coli M12|protein YjdP
MKRFPLFLLFTLLTLSTVPAQADIIDDTIGNIQQAINDAYNPDRGRDYEDSRDDGWQREVNDDRRRQYDDRRRQFEDRRRQLDDRQRQLDQERRQLEDEERRMEDEYGR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.01 | 2.8e-31 | ●○○○○ -0.29 | -0.291179324662694 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.77 | 1.1e-19 | ○○○○○ 1.12 | 1.1242752360015809 | 29101196 |
Retrieved 2 of 2 entries in 1.6 ms
(Link to these results)