Bacterial taxon 1392858
Locus CO715_12895
Protein ATI06525.1
protein-export membrane protein SecG
Escherichia coli M12
Length 110 aa, Gene n/a, UniProt n/a
>ATI06525.1|Escherichia coli M12|protein-export membrane protein SecG
MYEALLVVFLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFFIISLVLGNINSNKTNKGSEWENLSAPAKTEQTQPAAPAKPTSDIPN
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.35 | 1.7e-7 | ●●○○○ -1.4 | -1.404305810680369 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.31 | 5.1e-5 | ●○○○○ -0.56 | -0.5609586210864715 | 29101196 |
Retrieved 2 of 2 entries in 1.5 ms
(Link to these results)