Bacterial taxon 1392858
Locus CO715_05590
Protein ATI05248.1
protein-serine/threonine phosphatase
Escherichia coli M12
Length 218 aa, Gene n/a, UniProt n/a
>ATI05248.1|Escherichia coli M12|protein-serine/threonine phosphatase
MKQPAPVYQRIAGHQWRHIWLSGDIHGCLEQLRRKLWHCGFEPWRDLLISVGDVIDRGPQSLRCLQLLEQHWVRAVRGNHEQMAMDALASQQMSLWLMNGGDWFIALADNQQKQAKTALEKCQHLPFILEVHSRTGKHVIAHADYPDDVYEWQKDVDLHQVLWSRSRLGERQKGQGITGADHFWFGHTPLRHRVDIGNLHYIDTGAVFGGELTLVQLQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.51 | 0.001 | ●●○○○ -1.02 | -1.0208144364909617 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.71 | 0.017 | ●○○○○ -0.65 | -0.6452516108430115 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)