Bacterial taxon 1392858
Locus CO715_15615
Protein ATI07014.1
PTS fructose-like transporter subunit EIIB
Escherichia coli M12
Length 113 aa, Gene n/a, UniProt n/a
>ATI07014.1|Escherichia coli M12|PTS fructose-like transporter subunit EIIB
MAYLVAVTACVSGVAHTYMAAERLEKLCQLEKWGVSIETQGALGTENRLADEDIRRADVALLITDIELAGAERFEHCRYVQCSIYAFLREPQRVMSAVRKVLSAPQQTHLILE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.15 | 1.3e-9 | ●●○○○ -1.15 | -1.1533046555389885 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.26 | 0.015 | ○○○○○ 1.02 | 1.0182830607631592 | 29101196 |
Retrieved 2 of 2 entries in 1.6 ms
(Link to these results)