Bacterial taxon 1392858
Locus CO715_16890
Protein ATI07244.1
PTS glucitol/sorbitol transporter subunit IIA
Escherichia coli M12
Length 123 aa, Gene n/a, UniProt n/a
>ATI07244.1|Escherichia coli M12|PTS glucitol/sorbitol transporter subunit IIA
MTVIYQTTITRIGASATDALSDQMLITFREGAPADLEEYCFIHCHGELKGALHPGLQFSLGQHRYPVTAVGSVAEDNLRELGHVTLRFDGLSEAEFPGTVHVAGPVPDDIAPGSVLKFESVKE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.32 | 3.9e-11 | ●○○○○ -0.15 | -0.14679628280248203 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 3.52 | 2.8e-13 | ○○○○○ 1.28 | 1.2805511006739778 | 29101196 |
Retrieved 2 of 2 entries in 1.8 ms
(Link to these results)