Bacterial taxon 1392858
Locus CO715_12680
Protein ATI06485.1
PTS N-acetylgalactosamine transporter subunit IIB
Escherichia coli M12
Length 157 aa, Gene n/a, UniProt n/a
>ATI06485.1|Escherichia coli M12|PTS N-acetylgalactosamine transporter subunit IIB
MPNIVLSRIDERLIHGQVGVQWVGFAGANLVLVANDEVAEDPVQQNLMEMVLAEGIAVRFWTLQKVIDNIHRAADRQKILLVCKTPADFLTLVKGGVPVNRINVGNMHYANGKQQIAKTVSVDAGDIAAFNDLKAAGVECFVQGVPTEPAVDLFKLL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -5.92 | 4.7e-5 | ●○○○○ -0.69 | -0.6892759198495213 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.17 | 0.022 | ●○○○○ -0.11 | -0.11487344262240624 | 29101196 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)