Bacterial taxon 1392858
Locus CO715_12725
Protein ATI06494.1
PTS N-acetylgalactosamine transporter subunit IID
Escherichia coli M12
Length 263 aa, Gene n/a, UniProt n/a
>ATI06494.1|Escherichia coli M12|PTS N-acetylgalactosamine transporter subunit IID
MGSEISKKDITRLGFRSSLLQASFNYERMQAGGFTWAMLPILKKIYKDDKPGLSAAMKDNLEFINTHPNLVGFLMGLLISMEEKGENRDTIKGLKVALFGPIAGIGDAIFWFTLLPIMAGICSSFASQGNLLGPILFFAVYLLIFFLRVGWTHVGYSVGVKAIDKVRENSQMIARSATILGITVIGGLIASYVHINVVTSFAIDSTHSVALQQDFFDKVFPNILPMAYTLLMYYFLRVKKAHPVLLIGVTFVLSIVCSAFGIL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.81 | 1.3e-6 | ●○○○○ -0.25 | -0.24819824572742855 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 6.27 | 2.1e-15 | ○○○○○ 1.85 | 1.8543276398583461 | 29101196 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)