Bacterial taxon 1392858
Locus CO715_18615
Protein ATI07552.1
PTS sorbitol transporter
Escherichia coli M12
Length 102 aa, Gene n/a, UniProt n/a
>ATI07552.1|Escherichia coli M12|PTS sorbitol transporter
MLITFDSNGPKDCLDYSLSLEPSFREESLMILPGDRLLLAGHDFLVTAVGKGAQQALFELGHLTLVFNGDLNPCHVGAVHLSGPVPNLRDLHGNLVIEEGRP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.54 | 3.9e-8 | ●○○○○ -0.4 | -0.4000925441005996 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.35 | 1.9e-9 | ○○○○○ 0.83 | 0.8279978957681978 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)