Bacterial taxon 1392858
Locus CO715_18620
Protein ATI07553.1
PTS sorbitol transporter subunit IIC
Escherichia coli M12
Length 173 aa, Gene n/a, UniProt n/a
>ATI07553.1|Escherichia coli M12|PTS sorbitol transporter subunit IIC
MWTVSLAEAFIHVFQVAGKIFLDMMTGLIPMLICLLLAINFLMKLVGTVRMEKVAALLGRSRILTYGVLPVLGWFFMSSPGALTLGKLLPEKSKPGYEDALGTPAHPLTSLFPHVVPSELFVWLGVAAGVKALGLPVTSLALRYIAAAMLIGLIRGIITEYLFLRLSKRGNAP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.22 | 5.4e-29 | ●○○○○ -0.96 | -0.960307092358792 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.59 | 0.015 | ○○○○○ 0.88 | 0.8776556471594269 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)