Bacterial taxon 1392858   Locus CO715_16065   Protein ATI07093.1

PTS sugar transporter subunit IIA

Escherichia coli M12

Length 146 aa, Gene n/a, UniProt n/a

>ATI07093.1|Escherichia coli M12|PTS sugar transporter subunit IIA
MLGWVITCHDDRAQEILDALEKKHGVLLQCRAVNFWRGLSSNMLSRMMCDALHEADSGEGVIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMLVYRETLSSAEFRERIVELGAPEVSSLWHQQQKNPPFVLKHNLYEY

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus BALB/c)mammary gland BTO:000081724 hnot available in this study-10.872.2e-5●●○○○ -1.72-1.720821814295891329101196
Mouse (Mus musculus BALB/c)spleen BTO:000128124 hnot available in this study-9.070.00061●●○○○ -1.35-1.346719510747682829101196
Retrieved 2 of 2 entries in 11 ms (Link to these results)