Bacterial taxon 1392858
Locus CO715_16065
Protein ATI07093.1
PTS sugar transporter subunit IIA
Escherichia coli M12
Length 146 aa, Gene n/a, UniProt n/a
>ATI07093.1|Escherichia coli M12|PTS sugar transporter subunit IIA
MLGWVITCHDDRAQEILDALEKKHGVLLQCRAVNFWRGLSSNMLSRMMCDALHEADSGEGVIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMLVYRETLSSAEFRERIVELGAPEVSSLWHQQQKNPPFVLKHNLYEY
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.87 | 2.2e-5 | ●●○○○ -1.72 | -1.7208218142958913 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.07 | 0.00061 | ●●○○○ -1.35 | -1.3467195107476828 | 29101196 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)