Bacterial taxon 1392858
Locus CO715_23165
Protein ATI08368.1
PTS sugar transporter subunit IIB
Escherichia coli M12
Length 92 aa, Gene n/a, UniProt n/a
>ATI08368.1|Escherichia coli M12|PTS sugar transporter subunit IIB
MKKILVACGTGMSTSTMIAHKLQEFLTEQGISATTAQCCLNEIPLNCNGMDLIVTSMRTNSDYGIPTLNGAALLTGINDDALKQQIKALLTQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.66 | 1.1e-10 | ○○○○○ 0.2 | 0.19976474686487658 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 0.75 | 0.0057 | ○○○○○ 0.7 | 0.7030189332331299 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)