Bacterial taxon 1392858
Locus CO715_02185
Protein ATI04645.1
PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB
Escherichia coli M12
Length 164 aa, Gene n/a, UniProt n/a
>ATI04645.1|Escherichia coli M12|PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB
MNITLARIDDRLIHGQVTTVWSKVANAQRIIICNDEVYNDEVRRTLLRQAAPPGMKVNVVNIEKAVAVYHNPQYQDETVFYLFTRPQDALAMVRQGVKIDTLNIGGMAWRPGKKQLTKAVSLDDDDINAFHELNNLGVILDLRVVASDPSINIIDKINEQLIAN
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.41 | 1.2e-10 | ○○○○○ 0.25 | 0.2519262504270919 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.82 | 4.7e-16 | ○○○○○ 0.93 | 0.9250182923939183 | 29101196 |
Retrieved 2 of 2 entries in 2 ms
(Link to these results)