Bacterial taxon 1392858
Locus CO715_01475
Protein ATI04517.1
quaternary ammonium compound-resistance protein SugE
Escherichia coli M12
Length 105 aa, Gene n/a, UniProt n/a
>ATI04517.1|Escherichia coli M12|quaternary ammonium compound-resistance protein SugE
MSWIILVIAGLLEVVWAVGLKYTHGFSRLTPSVITVTAMIVSMALLAWAMKSLPVGTAYAVWTGIGAVGAAITGIVLLGESANPMRLASLALIVLGIIGLKLSTH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.66 | 1.4e-7 | ●○○○○ -0.22 | -0.21773592764709482 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -2.59 | 0.00037 | ○○○○○ 0.01 | 0.006767183684679906 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)