Bacterial taxon 1392858   Locus CO715_13955   Protein ATI06712.1

Rcs stress response system protein RcsF

Escherichia coli M12

Length 134 aa, Gene n/a, UniProt n/a

>ATI06712.1|Escherichia coli M12|Rcs stress response system protein RcsF
MRALPICLVALMLSGCSMLSRSPVEPVQSTAPQPKAEPAKPKAPRATPVRIYTNAEELVGKPFRDLGEVSGDSCQASNQDSPPSIPTARKRMQINASKMKANAVLLHSCEVTSGTPGCYRQAVCIGSALNITAK
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus BALB/c)spleen BTO:000128124 hnot available in this study-10.681.3e-10●●○○○ -1.68-1.682430947674100629101196
Mouse (Mus musculus BALB/c)mammary gland BTO:000081724 hnot available in this study3.121.7e-5○○○○○ 1.21.19792727903142929101196
Retrieved 2 of 2 entries in 1.6 ms (Link to these results)