Bacterial taxon 1392858
Locus CO715_24265
Protein ATI08552.1
ribonuclease HI
Escherichia coli M12
Length 155 aa, Gene n/a, UniProt n/a
>ATI08552.1|Escherichia coli M12|ribonuclease HI
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.84 | 0.01 | ●●○○○ -1.3 | -1.297479051384952 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.42 | 0.023 | ●●○○○ -1.21 | -1.2100563714146788 | 29101196 |
Retrieved 2 of 2 entries in 2.1 ms
(Link to these results)