Bacterial taxon 1392858
Locus CO715_09510
Protein ATI05928.1
ribonucleotide monophosphatase NagD
Escherichia coli M12
Length 250 aa, Gene n/a, UniProt n/a
>ATI05928.1|Escherichia coli M12|ribonucleotide monophosphatase NagD
MTIKNVICDIDGVLMHDNVAVPGAAEFLHGIMDKGLPLVLLTNYPSQTGQDLANRFATAGVDVPDSVFYTSAMATADFLRRQEGKKAYVVGEGALIHELYKAGFTITDVNPDFVIVGETRSYNWDMMHKAAYFVANGARFIATNPDTHGRGFYPACGALCAGIEKISGRKPFYVGKPSPWIIRAALNKMQAHSEETVIVGDNLRTDILAGFQAGLETILVLSGVSSLDDIDSMPFRPSWIYPSVAEIDVI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.74 | 2.1e-5 | ●○○○○ -0.65 | -0.6506764072134819 | 29101196 |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -4.3 | 0.0025 | ●○○○○ -0.35 | -0.3508520847378684 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)