Bacterial taxon 1392858
Locus CO715_20930
Protein ATI07973.1
ribosomal large subunit pseudouridine synthase C
Escherichia coli M12
Length 319 aa, Gene n/a, UniProt n/a
>ATI07973.1|Escherichia coli M12|ribosomal large subunit pseudouridine synthase C
MKTETPSVKIVAITADEAGQRIDNFLRTQLKGVPKSMIYRILRKGEVRVNKKRIKPEYKLEAGDEVRIPPVRVAEREEEAVSPHLQKVAALADVILYEDDHILVLNKPSGTAVHGGSGLSFGVIEGLRALRPEARFLELVHRLDRDTSGVLLVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKSVQAPLLKNILQSGERIVRVSQEGKPSETRFKVEERYAFATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDREFDRQLTEAGTGLNRLFLHAAALKFTHPGTGEVMRIEAPMDDGLKRCLQKLRNAR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.26 | 5.5e-23 | ●●○○○ -1.39 | -1.385944961426469 | 29101196 |
Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.16 | 0.035 | ○○○○○ 0.3 | 0.30492233804630264 | 29101196 |
Retrieved 2 of 2 entries in 2.7 ms
(Link to these results)